Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in proteins export. This sec-independent pathway is termed tat for twin-arginine translocation system. This system mainly transports proteins with bound cofactors that require folding prior to export.
ProductProbable protein TatB
CommentsRv1224, (MTCI61.07), len: 131 aa. Probable tatB, component of twin-arginine translocation protein export system (see citation below). Possible exported protein with hydrophobic stretch at N-terminus. Highly similar to Q49973|U15180 hypothetical protein U1756Y from Mycobacterium leprae (120 aa), FASTA scores: opt: 601, E(): 0, (73.3% identity in 131 aa overlap). A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004).
Functional categoryCell wall and cell processes
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Essential gene, determined by allelic exchange experiments (See Saint-Joanis et al., 2006).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS13674631367858+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1224|tatB
VFANIGWWEMLVLVMVGLVVLGPERLPGAIRWAASALRQARDYLSGVTSQLREDIGPEFDDLRGHLGELQKLRGMTPRAALTKHLLDGDDSLFTGDFDRPTPKKPDAAGSAGPDATEQIGAGPIPFDSDAT