Gene ML1254
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML1254, len: 215 aa. Conserved hypothetical protein. Highly similar to several proteins of unknown function including: Mycobacterium tuberculosis Rv2469c TR:O53196 (EMBL:AL021246) (222 aa), Fasta scores: E(): 0, 77.9% identity in 222 aa overlap and Streptomyces coelicolor TR:CAB71830 (EMBL:AL138662) (178 aa), Fasta scores: E(): 0, 52.8% identity in 161 aa overlap. Contains Pfam match to entry PF01844 HNH, HNH endonuclease. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1498709 | 1499356 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1254|ML1254
MVQRKNRRSHRSSGAAANLIRAANPSSLHNVDIHPSTCYESGSIWNRRRVLLLNSTYEPLTALPTRRAIIMVICGKADVVHVDPAGPVVHSATRSITVPSVIQLRSYVRVPYRARVPMTRAALMHRDRFCCAYCGAKADTVDHVVPRSRGGDHSWENCVACCSTCNHRKGDKLLTELGWVLRRTPVLPTGQHWRLLSTVKELDPAWARYLGGGAA
Bibliography
No article yet recorded