Gene Rv2469c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv2469c, (MTV008.25c), len: 222 aa. Conserved hypothetical protein, highly similar to other hypothetical proteins e.g. Q9X7B4|MLCB1610.15|ML1254 from Mycobacterium leprae (215 aa), FASTA scores: opt: 1183, E(): 3.3e-70, (77.9% identity in 222 aa overlap); Q9L1Y0|SC8E4A.25c from Streptomyces coelicolor (178 aa), FASTA scores: opt: 589, E(): 1.7e-31, (53.4% identity in 161 aa overlap) (N-terminal region is shorter 50 aa approximately); Q9RRS6|DR2409 conserved hypothetical protein from Deinococcus radiodurans (186 aa), FASTA scores: opt: 440, E(): 9.6e-22, (42.25% identity in 168 aa overlap) (N-terminal region is shorter 30 aa approximately); etc. |
| Functional category | Conserved hypotheticals |
| Proteomics | Predicted secreted protein - identified in culture filtrates of M. tuberculosis H37Rv; signal peptide predicted (See Malen et al., 2007). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2772367 | 2773035 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2469c|Rv2469c
MAHGKKRRGHRSSGVAAGVTGPASCLHSVHSHRLASGVETHPPNRHESASIWNRRRVLLLNSTYEPLTALSMRRAIVMVICGKADVVHEDPSGPVIHSATRSILVPSVIQLRSYVRVPYRARVPMTRAALMHRDRFCCAYCGGKADTVDHVVPRSRGGAHSWENCVACCSPCNHRKGDRLLTELGWALRRAPLPPTGPHWRLLSAVKELDPSWARYLGEGAA
Bibliography
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Målen H et al. [2007]. Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
