Gene ML1267
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable ionic transporter integral membrane protein ChaA |
| Comments | ML1267, len: 364 aa. Probable chaA, ionic transporter integral membrane protein, putative calcium/proton antiporter. Highly similar to many antiporters e.g. Mycobacterium tuberculosis Rv1607 TR:O53910 (EMBL:AL022001) (360 aa), Fasta scores: E(): 0, 77.7% identity in 364 aa overlap and Escherichia coli SW:CHAA_ECOLI (P31801) (366 aa), Fasta scores: E(): 0, 36.5% identity in 356 aa overlap. Contains multiple possible membrane spanning hydrophobic domains. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1510443 | 1511537 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1267|chaA
MLKRIAWTALVPLFALAVLALTWGREIGPVVTALQAALLTGAVLAAVHHAEVVAHRVGEPFGSLVLAAAVTVIEVALIVTLMASGENESWTLARDTAFAALMITTNGIAGFSLLLGSRRYGVTLFNAHGSGAALATLTTLATLSLVLPTFTTSHRGNEFSPGQLAFAAVASLGLYLLFVFTQTIRHRDFFLPVAQKGQKGLFEEDESHADPPSARSALISLALLLVALIAVVGLAELQSSAIEHLVTAVGFPQPFVGVVIATLVLLPETLAAVRAARRGRIQTSLNLAYGSAMASIGLTIPAIALASIWLTGPLILGLGATQLVLLALTVVISVLTVVPGRATRLQGEVHLVLLAAFVFLAIIP
Bibliography
No article yet recorded