Gene ML1276
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved membrane protein |
| Comments | ML1276, len: 146 aa. Conserved membrane protein. Similar to several proteins of undefined function including: Mycobacterium tuberculosis Rv1616 TR:O06133 (EMBL:Z95554) (132 aa), Fasta scores: E(): 0, 68.5% identity in 127 aa overlap and Streptomyces coelicolor TR:Q9S2U5 (EMBL:AL096884) (148 aa), Fasta scores: E(): 5.3e-11, 41.4% identity in 128 aa overlap. Contains possible membrane spanning hydrophobic domains. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1519221 | 1519661 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1276|ML1276
MELNQVSRAAQQRRQQDPHRRLYGVAGSGLLLAGAFGYIGFVDPHNADLVYPLCLFKLLTGWNCPFCGGLRLMHDLLHGDLAASVSDNVFLLVGIPVLVGWVVLRRRLGQSVLPTVALLTITVASIVWTVLRNVPGFPLVPTVYSG
Bibliography
No article yet recorded