Gene Rv1616
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved membrane protein |
| Comments | Rv1616, (MTCY01B2.08), len: 132 aa. Conserved membrane protein, with some similarity to other hypothetical proteins e.g. AL096884|SC4G6_9 from Streptomyces coelicolor cosmid 4G6 (148 aa), FASTA scores: opt: 245, E(): 1.7e-1 0, (36.7% identity in 128 aa overlap); Q55401|SLL0543 hypothetical 16.5 kDa protein from synechocystis SP (148 aa), FASTA scores: opt: 225, E(): 6.5e-10, (35.9% identity in 117 aa overlap). Has cysteine cluster and contains a rubredoxin signature (PS00202). |
| Functional category | Cell wall and cell processes |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1815683 | 1816081 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1616|Rv1616
MEASGRQRRYAAAGSVVLLAGALGYIGLVDPHNSNSLYPPCLFKLLTGWNCPACGGLRMIHDLLHGELAASINDNVFLLVGVPVLASWVLLRRRHGDLALPIPVMIAVAVAVIAWTVLRNLPGFPLVPTISG
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Bu L et al. [2008]. De novo prediction of the structures of M. tuberculosis membrane proteins. Structure
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
