Gene ML1298
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML1298, len: 250 aa. Conserved hypothetical protein. Highly similar to Mycobacterium tuberculosis hypothetical protein Rv2135c TR:O06240 (EMBL:Z95388) (236 aa), Fasta scores: E(): 0, 75.2% identity in 250 aa overlap. Also similar, in regions, to several putative phosphoglycerate mutases e.g. Escherichia coli SW:PMG2_ECOLI (P36942) (215 aa), Fasta scores: E(): 1.2e-06, 27.1% identity in 192 aa overlap. Contains Pfam match to entry PF00300 PGAM, Phosphoglycerate mutase family. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1546965 | 1547717 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1298|ML1298
MTVILLRHGRSTSNTAGVLAGRADGVDLDDRGREQAVGLIDRIAELPIRAVVCSPLLRCRRTINPLAETLCLEPFIDDRLSEVDYGEWTGRSIGDLAKEPLWQVVQAHPSAAVFPSGEGLAQVQVRAVAAIREYDRRFTSEHGGDTLWVACTHGDVIKAVIADAFGMHLDSFQRVIADPGSVSVIRYTQLRPFVLHVNHTGAQLSSALRAAMKPSGESHSDSCGERSGEIRNEPDAAVPSGDAVLGGSAD
Bibliography
No article yet recorded