Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductConserved protein
CommentsRv2135c, (MTCY270.33), len: 236 aa. Conserved protein. Function: unknown but equivalent to hypothetical Mycobacterium leprae protein, Q49773. FASTA best: Q49773 B2126_C1_148 opt: 1183, E() : 0; (74.8% identity in 250 aa overlap), also similar in C-terminus to PMG2_ECOLI P36942 probable phosphoglycerate mutase 2 (215 aa), FASTA scores; opt: 212, E(): 2.5e-07 27.9% identity in 190 aa overlap; and to Rv2228 and Rv2419c
Functional categoryConserved hypotheticals
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS23953012396011-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2135c|Rv2135c
MTVILLRHARSTSNTAGVLAGRSGVDLDEKGREQATGLIDRIGDLPIRAVASSPMLRCQRTVEPLAEALCLEPLIDDRFSEVDYGEWTGRKIGDLVDEPLWRVVQAHPSAAVFPGGEGLAQVQTRAVAAVREHDRRLADQHGHDVLWLACTHGDVIKAVIADAFGMHLDSFQRITADPGSVSVVRYTQLRPFVLHVNHTGARLAPALQAAASAQGASPEPNAAVPPGDAVIGGSTD