Gene ML1321
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | conserved hypothetical protein |
Comments | ML1321, len: 63 aa. Conserved hypothetical protein. Highly similar to many proteins of undefined function found upstream of bacterial proteasome beta subunits including: Mycobacterium smegmatis TR:O30517 (EMBL:AF009645) (64 aa), Fasta scores: E(): 6.2e-18, 82.8% identity in 64 aa overlap, Rhodococcus sp. TR:Q53082 (EMBL:U26422) (64 aa), Fasta scores: E(): 6.7e-17, 82.8% identity in 64 aa overlap and Mycobacterium tuberculosis Rv2111c TR:O33246 (EMBL:Z97559) (64 aa), Fasta scores: E(): 7.9e-19, 87.5% identity in 64 aa overlap. Note the high number of the amino acids Glu, Asp and Gly. Contains a possible coiled-coil region. |
Functional category | Conserved hypotheticals, Intermediary metabolism and respiration |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1575497 | 1575688 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1321|pup MAQEQTRRGGGGDDDEFTSSTSVGQERREKLTEETDDLLDEIDDVLEENAEDFVRAYVQKGGQ
Bibliography
No article yet recorded