Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in proteasomal degradation. Covalently binds to protein substrates.
ProductProkaryotic ubiquitin-like protein Pup
CommentsRv2111c, MTCY261.07c, len: 64 aa. Pup, prokaryotic ubiquitin-like protein (See Pearce et al., 2008). Highly similar to many. Pup|Rv2111c and Mpa|Rv2115c interact (See Pearce et al., 2008).
Functional categoryIntermediary metabolism and respiration
TranscriptomicsDNA microarrays show increased expression in M. tuberculosis H37Rv in BALB/c mice compared to SCID mice, after 21 days of infection (See Talaat et al., 2004).
RegulonPredicted to be in the SigB|Rv2710 regulon, in M. tuberculosis CDC1551 (See Lee et al., 2008).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019).essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS23705982370792-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2111c|pup
MAQEQTKRGGGGGDDDDIAGSTAAGQERREKLTEETDDLLDEIDDVLEENAEDFVRAYVQKGGQ