Gene Rv2111c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in proteasomal degradation. Covalently binds to protein substrates. |
| Product | Prokaryotic ubiquitin-like protein Pup |
| Comments | Rv2111c, MTCY261.07c, len: 64 aa. Pup, prokaryotic ubiquitin-like protein (See Pearce et al., 2008). Highly similar to many. Pup|Rv2111c and Mpa|Rv2115c interact (See Pearce et al., 2008). |
| Functional category | Intermediary metabolism and respiration |
| Transcriptomics | DNA microarrays show increased expression in M. tuberculosis H37Rv in BALB/c mice compared to SCID mice, after 21 days of infection (See Talaat et al., 2004). |
| Regulon | Predicted to be in the SigB|Rv2710 regulon, in M. tuberculosis CDC1551 (See Lee et al., 2008). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019).essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2370598 | 2370792 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2111c|pup
MAQEQTKRGGGGGDDDDIAGSTAAGQERREKLTEETDDLLDEIDDVLEENAEDFVRAYVQKGGQ
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Talaat AM et al. [2004]. The temporal expression profile of Mycobacterium tuberculosis infection in mice. Transcriptome
- Iyer LM et al. [2008]. Unraveling the biochemistry and provenance of pupylation: a prokaryotic analog of ubiquitination. Homology
- Lee JH et al. [2008]. Roles of SigB and SigF in the Mycobacterium tuberculosis sigma factor network. Regulon
- Pearce MJ et al. [2008]. Ubiquitin-like protein involved in the proteasome pathway of Mycobacterium tuberculosis. Function Product
- Sutter M et al. [2009]. A distinct structural region of the prokaryotic ubiquitin-like protein (Pup) is recognized by the N-terminal domain of the proteasomal ATPase Mpa. Biochemistry
- Liao S et al. [2009]. Pup, a prokaryotic ubiquitin-like protein, is an intrinsically disordered protein. Structure
- Striebel F et al. [2009]. Bacterial ubiquitin-like modifier Pup is deamidated and conjugated to substrates by distinct but homologous enzymes. Biochemistry
- Chen X et al. [2009]. Prokaryotic ubiquitin-like protein pup is intrinsically disordered. Structure
- Burns KE et al. [2009]. Proteasomal protein degradation in Mycobacteria is dependent upon a prokaryotic ubiquitin-like protein. Homology
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
