Gene ML1347
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML1347, len: 77 aa. Conserved hypothetical protein. Highly similar to proteins of unknown function from Mycobacterium tuberculosis Rv1684 TR:O33186 (EMBL:Z98268) (74 aa), Fasta scores: E(): 6.9e-20, 70.1% identity in 77 aa overlap and Streptomyces coelicolor TR:CAB88911 (EMBL:AL353862) (56 aa), Fasta scores: E(): 0.0064, 48.2% identity in 56 aa overlap. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1609118 | 1609351 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1347|ML1347
MLDDLLLSILVCPADRGPLVLVDQGYGAGGQSFYNPRLRRAYRIDDGIPVLLVDEARDVDDDEHAQLMVQAPTTDPQ
Bibliography
No article yet recorded