Gene ML1370
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | Hypothetical pseudouridine synthase (Uracil hydrolyase) |
Comments | ML1370, len: 257 aa. Hypothetical pseudouridine synthase (EC 4.2.1.70). Highly similar to several pseudouridylate synthases involved in the modification of ribosomal RNA e.g. Bacillus subtilis ribosomal large subunit pseudouridine synthase B SW:RLUB_BACSU (P35159) (229 aa), Fasta scores: E(): 3.6e-30, 42.8% identity in 229 aa overlap. Also highly similar to Mycobacterium tuberculosis Rv1711 SW:YH11_MYCTU (O33210) (254 aa), Fasta scores: E(): 0, 80.2% identity in 257 aa overlap. Contains Pfam match to entry PF01479 S4, S4 domain. Contains Pfam match to entry PF00849 PseudoU_synth_2, RNA pseudouridylate synthase. Contains PS01149 Rsu family of pseudouridine synthase signature. Belongs to the pseudouridine synthase rsuA family. |
Functional category | Information pathways, Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1630439 | 1631212 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1370|ML1370 LMVEIHDSRMDRGAGAVRLQKILSRAGIASRRAAEKLIIEGRVEVDGQLVRELGTRVDPDVSVVRVDGVKVVVDDSLVYLALNKPRGMYSTMSDDRGRPCVGDLIERRVRGNKKLFHVGRLDADTEGLILLTNDGELAHRLMHPSHEVSKTYLATVKGAVPRGLGKKLSVGLELDDGPAHVDDFAVVDAIPGKTLVRLTLHEGRKRIVRRLLTAAGFPVEMLVRTDIGAVSLGDQRPGCLRALLRDEIRQLYKEVGL
Bibliography
No article yet recorded