Gene ML1411
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable Arginine repressor ArgR (AHRC) |
| Comments | ML1411, len: 167 aa. Probable argR, Arginine repressor. Highly similar to many ArgR orthologues (which regulate the arginine biosynthetic genes) including: Bacillus stearothermophilus SW:ARGR_BACST (O31408) (149 aa), Fasta scores: E(): 2.3e-10, 33.8% identity in 154 aa overlap and Mycobacterium tuberculosis Rv1657 SW:ARGR_MYCTU (P94992) (170 aa), Fasta scores: E(): 0, 79.7% identity in 158 aa overlap. Belongs to the argR family. |
| Functional category | Regulatory proteins |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1693104 | 1693607 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1411|argR
MTHGASKTTPETTRAGRQARIVAILSSTSVRSQSELATLLADDGIDVTQATLSRDLEELGAVKLRGADGGVGVYVVPEDGSPVRGVSGGTARLSRLLSELLVSADSSANLAVLRTPPGAADYLASAIDRAALPYVVGTIAGDDTVFVAAREPMTGSELATVLESLNR
Bibliography
No article yet recorded