Gene Rv1657 (ahrC)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Regulates arginine biosynthesis genes |
| Product | Probable arginine repressor ArgR (AHRC) |
| Comments | Rv1657, (MTCY06H11.22), len: 170 aa. Probable argR, Arginine repressor (alternate gene name: ahrC). Similar to AHRC_BACSU|P17893 arginine hydroximate resistance protein from Bacillus subtilis (149 aa), FASTA scores: opt: 283, E(): 1.8e-11, (34.5% identity in 142 aa overlap); and ARGR_ECOLI|P15282 arginine repressor from Escherichia coli (156 aa), FASTA scores: opt: 194, E(): 6.4e-06, (30.8% identity in 146 aa overlap). Belongs to the ArgR family. |
| Functional category | Regulatory proteins |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1870842 | 1871354 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1657|argR
MSRAKAAPVAGPEVAANRAGRQARIVAILSSAQVRSQNELAALLAAEGIEVTQATLSRDLEELGAVKLRGADGGTGIYVVPEDGSPVRGVSGGTDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Cherney LT et al. [2008]. Crystal structure of the arginine repressor protein in complex with the DNA operator from Mycobacterium tuberculosis. Structure
- Cherney LT et al. [2008]. Structure of the C-terminal domain of the arginine repressor protein from Mycobacterium tuberculosis. Structure
- Cherney LT et al. [2009]. The structure of the arginine repressor from Mycobacterium tuberculosis bound with its DNA operator and Co-repressor, L-arginine. Structure
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
