Gene ML1423c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML1423c, len: 329 aa. Conserved hypothetical protein. Highly similar to several proteins of undefined function including: Bacillus subtilis SW:YQHO_BACSU (P54513) (291 aa), Fasta scores: E(): 2.8e-24, 37.3% identity in 308 aa overlap and Mycobacterium tuberculosis Rv2037c TR:O53481 (EMBL:AL021899) (324 aa), Fasta scores: E(): 0, 80.5% identity in 323 aa overlap. |
| Functional category | Conserved hypotheticals, Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1710511 | 1711500 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1423c|ML1423c
VLYLVIVSVVHADLVCQGGGIRGIGLVGAVDALATAGYRFPRVAGTSAGALVASLIAALQTAGEPLTRLAEVMRTIDYRKFFDRSLIGRVPLIGGGLSLLVSDGVYQGAYLEEWLTSLLGDLGVYTFGDLRTGEEPEQFAWSLVVTASDLSRRRLVRIPWDLDAYGINPDDFSVARAVHASSAIPYVFEPVQVAGATWVDGGLLSTFPVELFDRSDGDARWPTFGIRLSARPGIPPTHPVRGPVSLGIAAIETLVSNQDNAYIDDSCTMLRTIFVPADEVSPIDFNITVEQRQALYQSGLQAGQQFLKTWNYTEYLTACGRPVTRSAGL
Bibliography
No article yet recorded