Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductConserved transmembrane protein
CommentsRv2037c, (MTV018.24c), len: 324 aa. Conserved transmembrane protein, similar to many. Alternative nucleotide at position 2282787 (C->T; C312Y) has been observed. Contains IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase motif.
Functional categoryCell wall and cell processes
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
TranscriptomicsmRNA identified by microarray analysis and up-regulated after 96h of starvation (see citation below).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS22827472283721-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2037c|Rv2037c
VALVSTARVDLVCEGGGVRGIGLVGAVDALADAGYRFPRVAGSSAGAIVASLVAALQTAGEPVTRLAEMMRSIDYPKFLDRNLIGHVPLIGGGLSLLLSDGVYRGAYLEQLLGGLLADLGVHTFGDLRTGEAPEQFAWSLVVTASDLSRRRLVRIPWDLDSYGIHPDDFSVARAVHASSAIPFVFEPVRVRGATWVDGGLLSNFPVALFDRTDAEPRWPTFGIRLSARPGIPPTRPVQGPVSLGIAAIETLVSNQDNAYIDDPCTVRRTIFVPAHDVSPIDFDITAEQREALYQRGFQAGQKFLANWNYADCLADCGGPFTPSL