Gene ML1425c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable sugar-transport integral membrane protein ABC transporter |
| Comments | ML1425c, len: 283 aa. Probable sugar-transport integral membrane protein ABC transporter. Highly similar to many putative ABC_transport proteins e.g. Mycobacterium tuberculosis sugar transport protein Rv2039c TR:O53483 (EMBL:AL021899) (280 aa), Fasta scores: E(): 0, 79.2% identity in 283 aa overlap. Also similar to ML2039c from M. leprae. Contains multiple possible membrane spanning hydrophobic domains. Contains Pfam match to entry PF00528 BPD_transp, Binding-protein-dependent transport systems inner membrane component. Contains PS00402 Binding-protein-dependent transport systems inner membrane comp sign. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1712643 | 1713494 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1425c|ML1425c
VGLAERLNHIVKRSVLRAVVVYIALTGIAWCALFPIVWALSGSLKKEGEIREPTLLPAHPQWSNYTEVFDLIPFWRMFFNTVLYAGYVTVGQVFFCSLAGYAFARLQFRGRDALFVLYLGTLMMPLTVTIIPQFILMRVLGWTDTPWAMIVPGLFGSAFGTYLMRQFFRTLPSDLEEAAILDGCSPWQIYWRVLLPHAKPAVGVLAVLTWVNVWNDFLWPLLMIQRNSLATLTLGLVRMRGEYGTCWPVIMATSMLIILPLVIIYTIAQRAFVRGITVTRIGG
Bibliography
No article yet recorded