Gene Rv2039c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Thought to be involved in active transport of sugar across the membrane (import). Responsible for the translocation of the substrate across the membrane. |
| Product | Probable sugar-transport integral membrane protein ABC transporter |
| Comments | Rv2039c, (MTV018.26c), len: 280 aa. Probable sugar-transport integral membrane protein ABC transporter (see citation below), similar to many. Contains PS00402 Binding-protein-dependent transport systems inner membrane comp signature. Also contains possible helix-turn-helix motif at aa 171-192, although this is probably fortuitous. |
| Functional category | Cell wall and cell processes |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2284799 | 2285641 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2039c|Rv2039c
VGWADRIVHRHFIRGLALYAGLIGIAWCALFPIIWALSGSLKADGEVTEPTLFPSHPQWSNYREVFALMPFWRMFFNTVLYAGCVTAGQVFFCSLAGYAFARLQFRGRDTLFVLYLSTLMVPLTVTVIPQVILMRIVGWVDTPWAMIVPGLFGSAFGTYLMRQFFRTLPTDLEEAAILDGCSPWQIYWRILLPHSRPAVLVLGVLTWVNVWNDFLWPLLMIQRNSLATLTLGLVRLRGEYVARWPVLMAASMLMLVPLVILYAVAQRSFVRGIAVTGLGG
Bibliography
- Braibant M et al. [2000]. The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. Review Secondary
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Titgemeyer F et al. [2007]. A genomic view of sugar transport in Mycobacterium smegmatis and Mycobacterium tuberculosis. Homology
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
