Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionThought to be involved in active transport of sugar across the membrane (import). Responsible for the translocation of the substrate across the membrane.
ProductProbable sugar-transport integral membrane protein ABC transporter
CommentsRv2039c, (MTV018.26c), len: 280 aa. Probable sugar-transport integral membrane protein ABC transporter (see citation below), similar to many. Contains PS00402 Binding-protein-dependent transport systems inner membrane comp signature. Also contains possible helix-turn-helix motif at aa 171-192, although this is probably fortuitous.
Functional categoryCell wall and cell processes
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS22847992285641-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2039c|Rv2039c
VGWADRIVHRHFIRGLALYAGLIGIAWCALFPIIWALSGSLKADGEVTEPTLFPSHPQWSNYREVFALMPFWRMFFNTVLYAGCVTAGQVFFCSLAGYAFARLQFRGRDTLFVLYLSTLMVPLTVTVIPQVILMRIVGWVDTPWAMIVPGLFGSAFGTYLMRQFFRTLPTDLEEAAILDGCSPWQIYWRILLPHSRPAVLVLGVLTWVNVWNDFLWPLLMIQRNSLATLTLGLVRLRGEYVARWPVLMAASMLMLVPLVILYAVAQRSFVRGIAVTGLGG