Gene ML1547c
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | probable phosphopantetheinyl transferase, by homology with phosphopantetheinyl transferase pptT(Rv2794c) from M. tuberculosis H37Rv |
Comments | ML1547c, len: 227 aa. Highly similar to phosphopantetheinyl transferase pptT from Mycobacterium tuberculosis Rv2794c (227 aa), Fasta scores: E(): 0, 79.7% identity in 227 aa overlap. Weakly similar to a number of proteins essential for the production of iron chelators e.g. Escherichia coli enterobactin synthetase component D SW:ENTD_ECOLI (P19925) (209 aa), Fasta scores: E(): 0.002, 29.4% identity in 177 aa overlap. Also similar to Streptomyces sp. L-proline 3-hydroxylase TR:O24813 (EMBL:AB007189) (208 aa), Fasta scores: E(): 0, 50.7% identity in 209 aa overlap |
Functional category | Lipid metabolism |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 1871964 | 1872647 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1547c|pptT MTVSMLVSSVLPDYASQDLEYAELYSDPPGLTPLPEEELLIAKSVAKRRNEFITARYCARIALGRLRVPPVPILKGDKGEPCWPDGVVGSLTHCSGYRGAVVGRSAAVRSVGIDAEPHEMLPNGVLDVISLPEERSEMRRKLPSVLYWDRILFCAKEATYKAWFPLTKRWLGFEDAHITFDVDNLGSSGGFVSRILVDGSALSGPPLTVLTGRWSVDRGLVLTAIVL
Bibliography
No article yet recorded