Gene Rv2794c
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Biosynthesis of fatty acids and lipids. Transfers the 4'-phosphopantetheine moiety from coenzyme A to a SER of acyl-carrier protein. Catalyzes the formation of holo-ACP, which mediates the transfer of acyl fatty-acid intermediates during the biosynthesis of fatty acids and lipids [catalytic activity: CoA + APO-[acyl-carrier protein] = adenosine 3',5'-bisphosphate + holo-[acyl-carrier protein] ]. |
Product | Phosphopantetheinyl transferase PptT (CoA:APO-[ACP]pantetheinephosphotransferase) (CoA:APO-[acyl-carrier protein]pantetheinephosphotransferase) |
Comments | Rv2794c, (MTV002.59c), len: 227 aa. PptT, phosphopantetheinyl transferase, equivalent to Q9Z5I5|ML1547|MLCB596.23 putative iron-chelating complex subunit from Mycobacterium leprae (227 aa), FASTA scores: opt: 1248, E(): 9.1e-77, (79.75% identity in 227 aa overlap). Also highly similar to various proteins e.g. Q9F0Q6|PPTA phosphopantetheinyl transferase from Streptomyces verticillus (246 aa), FASTA scores: opt: 692, E(): 2.8e-39, (46.65% identity in 225 aa overlap); O88029|SC5A7.23 hypothetical 24.5 KDA protein from Streptomyces coelicolor (226 aa), FASTA scores: opt: 679, E(): 2e-38, (46.9% identity in 226 aa overlap); O24813 DNA for L-proline 3-hydroxylase from Streptomyces sp. (208 aa), FASTA scores: opt: 631, E(): 3.2e-35, (48.1% identity in 208 aa overlap); etc. |
Functional category | Lipid metabolism |
Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
Mutant | Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene in M. smegmatis and M. bovis BCG; C. glutamicum mutant does not produce corynomycolates, has altered colony morphology and slower growth rate compared to wild-type (See Chalut et al., 2006). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 3103257 | 3103940 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2794c|pptT MTVGTLVASVLPATVFEDLAYAELYSDPPGLTPLPEEAPLIARSVAKRRNEFITVRHCARIALDQLGVPPAPILKGDKGEPCWPDGMVGSLTHCAGYRGAVVGRRDAVRSVGIDAEPHDVLPNGVLDAISLPAERADMPRTMPAALHWDRILFCAKEATYKAWFPLTKRWLGFEDAHITFETDSTGWTGRFVSRILIDGSTLSGPPLTTLRGRWSVERGLVLTAIVL
Bibliography
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Chalut C et al. [2006]. The nonredundant roles of two 4'-phosphopantetheinyl transferases in vital processes of Mycobacteria. Biochemistry Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant