Gene ML1573c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible amidotransferase |
| Comments | ML1573c, len: 249 aa. Possible amidotransferase (EC 6.3.5.-). Similar to several e.g. Mycobacterium tuberculosis Rv2859c TR:O33341. Also similar in regions to Dictyostelium discoideum GMP synthase (EC 6.3.5.2) (glutamine amidotransferase) SW:GUAA_DICDI (P32073) (718 aa), Fasta scores: E(): 0.0045, 26.7% identity in 176 aa overlap. Contains Pfam match to entry PF00117 GATase, Glutamine amidotransferase class-I. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1898989 | 1899738 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1573c|ML1573c
VDLSGSRPVVGLTAYLEQVHTGLWDVPAGYLPADYFQGVAMAGGIAVLLPPQPVDPEIAGLALDGLDGLVITGGYDVDPATYGQRPHPSTDEPRTTRDSWEFALFEAALQRGLPVLGICRGAQLLNIALGGTLHQHLPEVIGHSKHWVGNAVFNNLLVRTVPGTRLAAVLGEFVEARCYHHQSIDKLGDGLVVSAWDADGVVEAVELPGDAFVLGVQWHPEKALSDLRLFTAIVDAACRYANSRCVEYS
Bibliography
No article yet recorded