Gene Rv2859c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown; probably involved in cellular metabolism. |
| Product | Possible amidotransferase |
| Comments | Rv2859c, (MTV003.05c), len: 308 aa. Possible amidotransferase, equivalent (but longer 58 aa) to Q9CBU9|ML1573 possible amidotransferase from Mycobacterium leprae (249 aa), FASTA scores: opt: 1226, E(): 3e-64, (71.55% identity in 239 aa overlap). Also similar to other amidotransferases and hypothetical proteins, but shorter in N-terminus e.g. O88072|SCI35.37 hypothetical 25.3 KDA protein from Streptomyces coelicolor (242 aa), FASTA scores: opt: 683, E(): 1.2e-32, (47.65% identity in 235 aa overlap); AAK79730|Q97I88|CAC1764 predicted glutamine amidotransferase from Clostridium acetobutylicum (241 aa), FASTA scores: opt: 458, E(): 1.6e-19, (32.95% identity in 246 aa overlap); AAK75201|Q97QV9|SP1089 glutamine amidotransferase class I from Streptococcus pneumoniae (229 aa), FASTA scores: opt: 431, E(): 5.6e-18, (34.75% identity in 236 aa overlap); etc. Contains three 17 aa repeats at the N-terminus very similar to those in other Mycobacterium tuberculosis proteins e.g. Q10699|YY30_MYCTU|Rv2090|MT2151|MTCY49.30 putative 5'-3' exonuclease RV2090. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3170720 | 3171646 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2859c|Rv2859c
VDLSASRSDGGDPLRPASPRLRSPVSDGGDPLRPASPRLRSPVSDGGDPLRPASPRLRSPLGASRPVVGLTAYLEQVRTGVWDIPAGYLPADYFEGITMAGGVAVLLPPQPVDPESVGCVLDSLHALVITGGYDLDPAAYGQEPHPATDHPRPGRDAWEFALLRGALQRGMPVLGICRGTQVLNVALGGTLHQHLPDILGHSGHRAGNGVFTRLPVHTASGTRLAELIGESADVPCYHHQAIDQVGEGLVVSAVDVDGVIEALELPGDTFVLAVQWHPEKSLDDLRLFKALVDAASGYAGRQSQAEPR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
