Gene ML1607c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML1607c, len: 96 aa. Conserved hypothetical protein. Similar to N terminus of Mycobacterium tuberculosis hypothetical protein Rv2898c SW:YS98_MYCTU (Q10819) (128 aa), Fasta scores: E(): 7.9e-19, 58.3% identity in 96 aa overlap. Contains Pfam match to entry PF02021 UPF0102, Uncharacterised protein family UPF0102. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1932707 | 1932997 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1607c|ML1607c
MTTHKAMTRVQLEAMGEVFAVDNLTRMGLRGLHCNWRCRYGECDVIASETAHRTVVSRLRSIAATVMEGSRRSAPEQKVRWLRWLAGLWPANQDEF
Bibliography
No article yet recorded