Gene Rv2898c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv2898c, (MTCY274.29c), len: 128 aa. Conserved hypothetical protein, highly similar to O33024|YS98_MYCLE|ML1607|MLCB250.49 hypothetical 11.0 KDA protein from Mycobacterium leprae (96 aa), FASTA scores: opt: 318, E(): 2.3e-16, (58.35% identity in 96 aa overlap). Also similar to other hypothetical proteins e.g. O69890|YE19_STRCO|SC2E1.19 from Streptomyces coelicolor (130 aa), FASTA scores: opt: 253, E(): 1.7e-11, (39.65% identity in 121 aa overlap); Q9HVZ1|PA4424 from Pseudomonas aeruginosa (125 aa), FASTA scores: opt: 234, E(): 4.2e-10, (40.85% identity in 115 aa overlap); O86871 from Streptomyces lividans (85 aa), FASTA scores: opt: 224, E(): 1.8e-09, (46.45% identity in 84 aa overlap); etc. Equivalent to AAK47292 from Mycobacterium tuberculosis strain CDC1551 (141 aa) but shorter 13 aa. A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004). |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3207942 | 3208328 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2898c|Rv2898c
MTTLKTMTRVQLGAMGEALAVDYLTSMGLRILNRNWRCRYGELDVIACDAATRTVVFVEVKTRTGDGYGGLAHAVTERKVRRLRRLAGLWLADQEERWAAVRIDVIGVRVGPKNSGRTPELTHLQGIG
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Marmiesse M, Brodin P, Buchrieser C, Gutierrez C, Simoes N, Vincent V, Glaser P, Cole ST and Brosch R [2004]. Macro-array and bioinformatic analyses reveal mycobacterial 'core' genes, variation in the ESAT-6 gene family and new phylogenetic markers for the Mycobacterium tuberculosis complex. Homology
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant