Gene ML1635
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable 3-methyl-2-oxobutanoate hydroxymethyltransferase PanB |
| Comments | ML1635, len: 286 aa. Probable panB, 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11). Highly similar to 3-methyl-2-oxobutanoate hydroxymethyltransferases from Escherichia coli SW:PANB_ECOLI (P31057) (264 aa), Fasta scores: E(): 0, 45.9% identity in 257 aa overlap and Mycobacterium tuberculosis Rv2225 SW:PANB_MYCTU (Q10505) (281 aa), Fasta scores: E(): 0, 82.6% identity in 287 aa overlap. Also similar to ML1718 a possible pseudogene similar to M. tuberculosis panB. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1969135 | 1969995 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1635|panB
MSEQNVNVYGADPSTSSIQSIQRTKIRTKHLQKMKAEGHKWAMLTAYDYSTARVFDEAGIPVLLVGDSAANVVYGYDTTVPVSADELLPLVRGVVRGAGHALVVADLPFGSYEPGPTAALAVATRFMKEGGAHAVKLEGGQRVAEQIACLTAAGIPVMAHIGFTPQSVNSLGGFRVQGRGGDAEQTVADAVAVAEAGAFSVVMEMVPTELATQITGKLTIPTIGIGAGLNCDAQVLVWQDMAGLSSGKVARFVKQYADIAGELRRAAMQYAEEVASAVFPAEEHCF
Bibliography
No article yet recorded