Gene ML1660c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML1660c, len: 217 aa. Conserved hypothetical protein. Similar to several proteins of undefined function e.g. Mycobacterium tuberculosis Rv2926c TR:YT26_MYCTU (207 aa), fasta scores: E(): 6.5e-53, (67.188% identity in 192 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2001614 | 2002267 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1660c|ML1660c
VTVALALRDGCRRISTMTRQYGVTTQRHLISPVVFDITPLGRRPGAIIALQKTVPSLARIGLELVVIEWGAPINLDLRVESVSEDVLVAGTVTAPTVSECVRCLTAVHGHVQVTLNQLFAYPYSATKVTTEEDAVGHVVDGTIDLEQSIIDAVGIELPFAPMCRSDCPGLCAECGTSLVVEPGHPHDRIDPWWAKLTDMLAPDVPQTSETDGSRSEW
Bibliography
No article yet recorded