Gene Rv2926c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved protein |
| Comments | Rv2926c, (MTCY338.15c), len: 207 aa. Conserved protein, equivalent to O69468|ML1660|MLCB1243.14 hypothetical 23.5 KDA protein from Mycobacterium leprae (217 aa), FASTA scores: opt: 866, E(): 1.4e-48, (67.2% identity in 192 aa overlap). Also similar in part to other hypothetical proteins e.g. Q9WXZ8 conserved hypothetical protein from Thermotoga maritima (182 aa), FASTA scores: opt: 254, E(): 3.4e-09, (31.45% identity in 143 aa overlap); Q9ZBQ9|SC7A1.14 hypothetical 23.5 KDA protein from Streptomyces coelicolor (217 aa), FASTA scores: opt: 244, E(): 1.7e-08, (45.5% identity in 189 aa overlap); O65982 hypothetical 26.2 KDA protein from Clostridium thermosaccharolyticum (Thermoanaerobacterium thermosaccharolyticum) (228 aa), FASTA scores: opt: 220, E(): 6.1e-07, (32.45% identity in 148 aa overlap); etc. Equivalent to AAK47323 from Mycobacterium tuberculosis strain CDC1551 (195 aa) but longer 12 aa. |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by microarray analysis and up-regulated after 24h and 96h of starvation (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3240548 | 3241171 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2926c|Rv2926c
VDLGGVRRRISLMARQHGPTAQRHVASPMTVDIARLGRRPGAMFELHDTVHSPARIGLELIAIDQGALLDLDLRVESVSEGVLVTGTVAAPTVGECARCLSPVRGRVQVALTELFAYPDSATDETTEEDEVGRVVDETIDLEQPIIDAVGLELPFSPVCRPDCPGLCPQCGVPLASEPGHRHEQIDPRWAKLVEMLGPESDTLRGER
Bibliography
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
