Gene ML1680
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML1680, len: 216 aa. Conserved hypothetical protein. Highly similar to several proteins of undefined function including: Mycobacterium tuberculosis Rv2983 TR:P95112 (EMBL:Z83018) (214 aa), Fasta scores: E(): 0, 79.1% identity in 215 aa overlap and Streptomyces coelicolor TR:Q9ZBS2 (EMBL:AL034447) (212 aa), Fasta scores: E(): 1.2e-17, 41.1% identity in 207 aa overlap. Contains Pfam match to entry PF01983 DUF121, Protein of unknown function. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2024688 | 2025338 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1680|ML1680
MSGTRAGGTADVGLIIAVKRLAAAKTRLGPVFSTRTRENVVLAMLVDTLTAAAPVSALRSITVITPDEAAAAAAAEFGAEILADPTPDGHGDPLNNAIAAAEHAIAGSFSNIVVLQGDLPALQTQELSEAIAAARHHQRSFVADRLGSGTAALCTFGTALNPQFGPDSSAQHRRSGAIELTGPWPGLRCDVDTPADLAAARRLGIGAATTRVVAHL
Bibliography
No article yet recorded