Gene Rv2983 
in Mycobacterium tuberculosis H37Rv
General annotation
      | Type | CDS | 
| Function | Function unknown | 
| Product | Conserved hypothetical alanine rich protein | 
| Comments | Rv2983, (MTCY349.04c), len: 214 aa. Conserved hypothetical ala-rich protein, equivalent to O33128|ML1680|MLCB637.37c hypothetical 22.0 KDA protein from Mycobacterium leprae (216 aa), FASTA scores: opt: 1080, E(): 9e-61, (79.05% identity in 215 aa overlap). Also similar to other hypothetical proteins e.g. Q9ZBS2|SC7A1.01C from Streptomyces coelicolor (212 aa), FASTA scores: opt: 420, E(): 2.9e-19, (43.5% identity in 207 aa overlap); O26710|MTH613 from Methanothermobacter thermautotrophicus (223 aa), FASTA scores: opt: 193, E(): 5.8e-05, (30.0% identity in 190 aa overlap); Q9RKG8|SCE46.21 from Streptomyces coelicolor (210 aa), FASTA scores: opt: 139, E(): 0.14, (27.65% identity in 206 aa overlap); etc. | 
| Functional category | Conserved hypotheticals | 
| Proteomics | Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). | 
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 3339118 | 3339762 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium tuberculosis H37Rv|Rv2983|Rv2983
MSGTPDDGDIGLIIAVKRLAAAKTRLAPVFSAQTRENVVLAMLVDTLTAAAGVGSLRSITVITPDEAAAAAAAGLGADVLADPTPEDDPDPLNTAITAAERVVAEGASNIVVLQGDLPALQTQELAEAISAARHHRRSFVADRLGTGTAVLCAFGTALHPRFGPDSSARHRRSGAVELTGAWPGLRCDVDTPADLTAARQLGVGPATARAVAHR
      
    Bibliography
    - Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant