Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical alanine rich protein
CommentsRv2983, (MTCY349.04c), len: 214 aa. Conserved hypothetical ala-rich protein, equivalent to O33128|ML1680|MLCB637.37c hypothetical 22.0 KDA protein from Mycobacterium leprae (216 aa), FASTA scores: opt: 1080, E(): 9e-61, (79.05% identity in 215 aa overlap). Also similar to other hypothetical proteins e.g. Q9ZBS2|SC7A1.01C from Streptomyces coelicolor (212 aa), FASTA scores: opt: 420, E(): 2.9e-19, (43.5% identity in 207 aa overlap); O26710|MTH613 from Methanothermobacter thermautotrophicus (223 aa), FASTA scores: opt: 193, E(): 5.8e-05, (30.0% identity in 190 aa overlap); Q9RKG8|SCE46.21 from Streptomyces coelicolor (210 aa), FASTA scores: opt: 139, E(): 0.14, (27.65% identity in 206 aa overlap); etc.
Functional categoryConserved hypotheticals
ProteomicsIdentified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS33391183339762+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2983|Rv2983
MSGTPDDGDIGLIIAVKRLAAAKTRLAPVFSAQTRENVVLAMLVDTLTAAAGVGSLRSITVITPDEAAAAAAAGLGADVLADPTPEDDPDPLNTAITAAERVVAEGASNIVVLQGDLPALQTQELAEAISAARHHRRSFVADRLGTGTAVLCAFGTALHPRFGPDSSARHRRSGAVELTGAWPGLRCDVDTPADLTAARQLGVGPATARAVAHR