Gene ML1809c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML1809c, len: 320 aa. Conserved hypothetical protein. Similar to M. tuberculosis Rv1480 SW:YE80_MYCTU (P71761) (317 aa), Fasta scores: E(): 0, 87.5% identity in 311 aa overlap. Contains Pfam match to entry PF01882 DUF58, Protein of unknown function. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2189526 | 2190488 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1809c|ML1809c
VIDPNPAAKPGVFHPPSMQRGQIDDPKLSAALRTLELTVKRKLDGVLHGDHLGLISGPGSEPGESRVYQPGDDVRRMDWAVTARTTHPHVRQMIADRELETWMVIDMSASLDFGTTICEKRDLAVAAAAAITFLNSGGGNRLGALICNGARMTRVPARSGRQHEQTLLRTIATTPKAPVGVRGDLTVAIDALRRPERRRGMAVIISDFLGPINWMRPLRAIAARHEVLGIEVLDPRDVALPDIGEVVLQDAETGVTREFTIDAALRDDFARAAAAHCADVSRSLRNCGAPLMSLRTDRDWIADIVRFVESRRRGALAGRQ
Bibliography
No article yet recorded