Gene Rv1480
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved protein |
| Comments | Rv1480, (MTV007.27,MTCY227.01), len: 317 aa. Conserved protein, last 110 aa residues correspond to first 110 aa of YS01_MYCAV|O07394 hypothetical 18.7 kDa Mycobacterium avium protein MAV169 (169 aa), FASTA scores: opt: 642, E(): 0, (84.2% identity in 114 aa overlap). Also similar to Mycobacterium tuberculosis hypothetical proteins Rv3163c and Rv3693. |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019).Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1670413 | 1671366 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1480|Rv1480
VTESKAPAVVHPPSMLRGDIDDPKLAAALRTLELTVKQKLDGVLHGDHLGLIPGPGSEPGESRLYQPGDDVRRMDWAVTARTTHPHVRQMIADRELETWLVVDMSASLDFGTACCEKRDLAVAAAAAITFLNSGGGNRLGALIANGAAMTRVPARTGRQHQHTMLRTIATMPQAPAGVRGDLAVAIDALRRPERRRGMAVIISDFLGPINWMRPLRAIAARHEVLAIEVLDPRDVELPDVGDVVLQDAESGVVREFSIDPALRDDFARAAAAHRADVARTIRGCGAPLLSLRTDRDWLADIVRFVASRRRGALAGHQ
Bibliography
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
