Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved protein
CommentsRv1480, (MTV007.27,MTCY227.01), len: 317 aa. Conserved protein, last 110 aa residues correspond to first 110 aa of YS01_MYCAV|O07394 hypothetical 18.7 kDa Mycobacterium avium protein MAV169 (169 aa), FASTA scores: opt: 642, E(): 0, (84.2% identity in 114 aa overlap). Also similar to Mycobacterium tuberculosis hypothetical proteins Rv3163c and Rv3693.
Functional categoryConserved hypotheticals
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cytosol of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019).Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS16704131671366+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1480|Rv1480
VTESKAPAVVHPPSMLRGDIDDPKLAAALRTLELTVKQKLDGVLHGDHLGLIPGPGSEPGESRLYQPGDDVRRMDWAVTARTTHPHVRQMIADRELETWLVVDMSASLDFGTACCEKRDLAVAAAAAITFLNSGGGNRLGALIANGAAMTRVPARTGRQHQHTMLRTIATMPQAPAGVRGDLAVAIDALRRPERRRGMAVIISDFLGPINWMRPLRAIAARHEVLAIEVLDPRDVELPDVGDVVLQDAESGVVREFSIDPALRDDFARAAAAHRADVARTIRGCGAPLLSLRTDRDWLADIVRFVASRRRGALAGHQ