Gene ML1908c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML1908c, len: 166 aa. Conserved hypothetical protein. Similar to M. tuberculosis hypothetical protein Rv0637 TR:P96928 (EMBL:Z92772) (166 aa), Fasta scores: E(): 0, 88.6% identity in 166 aa overlap, and to others e.g. Streptomyces coelicolor SCD82.07 TR:CAB77410 (EMBL:AL160431) (150 aa), Fasta scores: E(): 4.7e-11, 29.3% identity in 150 aa overlap. Also similar to ML1910 and ML2425 from M. leprae. |
| Functional category | Conserved hypotheticals, Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2293151 | 2293651 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML1908c|ML1908c
VALKTDIRGMVWRYSDYFIVGREQCREFARAIKCDHPAYFSEDAAAELGYDAIVAPLTFVTIFAKYVQLDFFRNVDVGMETMQIVQVDQRFVFHKPVLVGDKLWARMDIHSVSERFGADIVVTKNSCTSDDGELVMEAYTTLMGQQGDNSSQLKWDKESGQVIRSA
Bibliography
No article yet recorded