Gene Rv0637
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in fatty acid synthesis type II (fas-II) |
| Product | (3R)-hydroxyacyl-ACP dehydratase subunit HadC |
| Comments | Rv0637, (MTCY20H10.18), len: 166 aa. HadC, (3R)-hydroxyacyl-ACP dehydratase subunit, equivalent to NP_302285.1|NC_002677|YV31_MYCLE|P54879 conserved hypothetical protein from Mycobacterium leprae (166 aa), FASTA scores: opt: 352, E(): 4e-19, (39.2% identity in 148 aa overlap); and highly similar to others from Mycobacterium leprae e.g. NP_302287.1|NC_002677 conserved hypothetical protein (159 aa). Also highly similar to CAB77410.1|AL160431|SCD82.07 hypothetical protein from Streptomyces coelicolor (150 aa); Rv0635|NP_215149.1|NC_000962|MTY20H10_17 conserved hypothetical protein (two ORFs upstream) from Mycobacterium tuberculosis (158 aa), FASTA score: (49.3% identity in 150 aa overlap); and Rv0504c|NP_215018.1|NC_000962|YV31_MYCTU|Q11168 hypothetical protein from Mycobacterium tuberculosis (166 aa), FASTA scores: opt: 380, E(): 3.8e-21, (43.1% identity in 137 aa overlap). |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 732825 | 733325 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0637|hadC
MALKTDIRGMIWRYPDYFIVGREQCREFARAVKCDHPAFFSEEAAADLGYDALVAPLTFVTILAKYVQLDFFRHVDVGMETMQIVQVDQRFVFHKPVLAGDKLWARMDIHSVDERFGADIVVTRNLCTNDDGELVMEAYTTLMGQQGDGSARLKWDKESGQVIRTA
Bibliography
- Dahl JL et al. [2003]. The role of RelMtb-mediated adaptation to stationary phase in long-term persistence of Mycobacterium tuberculosis in mice. Regulon
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Sacco E, Covarrubias AS, O'Hare HM, Carroll P, Eynard N, Jones TA, Parish T, Daffe M, Backbro K and Quemard A [2007]. The missing piece of the type II fatty acid synthase system from Mycobacterium tuberculosis. Function Product
- Gurvitz A, Hiltunen JK and Kastaniotis AJ [2009]. Heterologous expression of mycobacterial proteins in Saccharomyces cerevisiae reveals two physiologically functional 3-hydroxyacyl-thioester dehydratases, HtdX and HtdY, in addition to HadABC and HtdZ. Function
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
