Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in fatty acid synthesis type II (fas-II)
Product(3R)-hydroxyacyl-ACP dehydratase subunit HadC
CommentsRv0637, (MTCY20H10.18), len: 166 aa. HadC, (3R)-hydroxyacyl-ACP dehydratase subunit, equivalent to NP_302285.1|NC_002677|YV31_MYCLE|P54879 conserved hypothetical protein from Mycobacterium leprae (166 aa), FASTA scores: opt: 352, E(): 4e-19, (39.2% identity in 148 aa overlap); and highly similar to others from Mycobacterium leprae e.g. NP_302287.1|NC_002677 conserved hypothetical protein (159 aa). Also highly similar to CAB77410.1|AL160431|SCD82.07 hypothetical protein from Streptomyces coelicolor (150 aa); Rv0635|NP_215149.1|NC_000962|MTY20H10_17 conserved hypothetical protein (two ORFs upstream) from Mycobacterium tuberculosis (158 aa), FASTA score: (49.3% identity in 150 aa overlap); and Rv0504c|NP_215018.1|NC_000962|YV31_MYCTU|Q11168 hypothetical protein from Mycobacterium tuberculosis (166 aa), FASTA scores: opt: 380, E(): 3.8e-21, (43.1% identity in 137 aa overlap).
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS732825733325+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0637|hadC
MALKTDIRGMIWRYPDYFIVGREQCREFARAVKCDHPAFFSEEAAADLGYDALVAPLTFVTILAKYVQLDFFRHVDVGMETMQIVQVDQRFVFHKPVLAGDKLWARMDIHSVDERFGADIVVTRNLCTNDDGELVMEAYTTLMGQQGDGSARLKWDKESGQVIRTA