Gene ML2054c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | probable integral membrane protein |
| Comments | ML2054c, len: 99 aa. Probable integral membrane protein. Similar to Mycobacterium tuberculosis hypothetical protein TR:P95154 (EMBL:Z83859) fasta scores: E(): 6.4e-18, 58.4% in 101 aa, and to Escherichia coli transglycosylase associated protein SW:TAG1_ECOLI (P76011) fasta scores: E(): 0.0054, 35.1% in 77 aa. |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2442189 | 2442488 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML2054c|ML2054c
MDVMAATEYLARSTTLTSVGWIGYIIIGGIAGWIAGKIVQGGGSGILMNIVIGVVGALIGGFLLSFFVNTAAGGWWFTLFTSILGSVILLWVVGRVRKT
Bibliography
No article yet recorded