Gene Rv1861
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Probable conserved transmembrane protein |
| Comments | Rv1861, (MTCY359.12c), len: 101 aa. Probable conserved transmembrane protein, showing weak similarity to AE002069|AE002069_10 hypothetical protein from Deinococcus radiodurans (146 aa), FASTA scores: opt: 154, E(): 0.0027, (30.8% identity in 104 aa overlap). Contains PS00017 ATP/GTP-binding site motif A (P-loop). A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004). |
| Functional category | Cell wall and cell processes |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2109165 | 2109470 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv1861|Rv1861
MDITATTEFSAMNLDGKTGIGWLGYIVIGGIAGWLASKIVKGGGSGILMNVVIGVVGAFGAGLVLNALGVDVNHGGYWFTFFVALGGAVVLLWIVGMVRKT
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Marmiesse M, Brodin P, Buchrieser C, Gutierrez C, Simoes N, Vincent V, Glaser P, Cole ST and Brosch R [2004]. Macro-array and bioinformatic analyses reveal mycobacterial 'core' genes, variation in the ESAT-6 gene family and new phylogenetic markers for the Mycobacterium tuberculosis complex. Homology
- Li C et al. [2007]. Uniformly aligned full-length membrane proteins in liquid crystalline bilayers for structural characterization. Structure
- Bu L et al. [2008]. De novo prediction of the structures of M. tuberculosis membrane proteins. Structure
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant