Gene ML2155c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML2155c, len: 74 aa. Conserved hypothetical protein. Similar to C-terminus of Mycobacterium tuberculosis hypothetical protein Rv0863 TR:O53875 (EMBL:AL022004) fasta scores: E(): 1.5e-21, 74.0% in 73 aa. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2556723 | 2556947 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML2155c|ML2155c
MKSVNYYVVADIAKSKAHKSRYVDNGWPTTDPDHHAVSELVTDCAGALSPFGDLVFPVPADDLPYVHPVTVVNR
Bibliography
No article yet recorded