Gene ML2207c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML2207c, len: 131 aa. Conserved hypothetical protein. Similar to Mycobacterium tuberculosis hypothetical protein Rv0807 or MTCY07H7A.02C TR:O06627 (EMBL:Z95618) (129 aa) fasta scores: E(): 0, 73.4% identity in 128 aa. Similar to Corynebacterium ammoniagenes ORF3 TR:Q9RHY2 (EMBL:AB003158) (132 aa) fasta scores: E(): 4.4e-22, 51.2% identity in 125 aa and to Streptomyces coelicolor hypothetical protein SCD25.20 TR:Q9RKK0 (EMBL:AL118514) (202 aa) fasta scores: E(): 6.6e-16, 52.5% identity in 101 aa. Previously sequenced as TR:O05761 (EMBL:Z95151). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2622304 | 2622699 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML2207c|ML2207c
MAVCDRADPAKTRQAVLALADWLKDRTLPAPDRDAVATAVRLTVRTLATLAPGASVEVRIPPYVAVQCVSGPSHTRGTPPNVVETDSRTWLLVATGLMQLVEAVATGALRMSGSRAGDIEVWMPLINLRCT
Bibliography
No article yet recorded