Gene Rv0807
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv0807, (MTCY07H7A.02c), len: 129 aa. Conserved hypothetical protein, equivalent to O05761|MLCB5_31 hypothetical 14.0 kDa protein from Mycobacterium leprae (131 aa), FASTA scores: E(): 0, (73.4% identity in 128 aa overlap). Also highly similar to BAA89438.1|AB003158|ORF3 hypothetical protein from Corynebacterium ammoniagenes (132 aa); and C-terminus of SCD25.20|CAB56364.1|AL118514 hypothetical protein from Streptomyces coelicolor (202 aa). |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 901635 | 902024 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0807|Rv0807
MSARDRVDPAKTRQVVLALADWLRDETLPAPDTDVLAAAVRLTARTLAALAPGASVEVRIPPFAAVQCISGPRHTRGTPPNVVQTDPRTWLLVATGLSGVAQARGSGALQLSGSRAGEIEAWLPLVDLG
Bibliography
- Parish T, Smith DA, Roberts G, Betts J and Stoker NG [2003]. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Regulation
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
