Gene ML2210c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML2210c, len: 317 aa. Conserved hypothetical protein. Similar to Mycobacterium tuberculosis hypothetical protein Rv0805 TR:O06629 (EMBL:Z95618) fasta scores: E(): 0, 82.5% id in 315 aa, and to Escherichia coli IcC protein ICC SW:ICC_ECOLI (P36650) fasta scores: E(): 1.2e-12, 30.7% identity in 215 aa. |
| Functional category | Conserved hypotheticals, Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2625874 | 2626827 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML2210c|ML2210c
VHRLRAAEHPRPDYVLLHISDTHLISDGSLYGAVDADSRLGELLEQLKHSQLRPDAIIFTGDLADRGEPEAYRKLRCLVESFATELDAELFWVMGNHDNRVALRTLLLDEAPSMAPLDGVRRVDGLRVITLDTSVPGRHYGEISASQLDWLADELTTSAPDGTILALHHPPIPSVLDMAVTVELRDQASLGRVLKGSDIRAILAGHLHYSTNATFVGIPVSVASATCYTQDLTVVAGGARGRDGAQGCNLVHVYQDTVVHSVIPLGIGNMVGTFVSPAQARRDIAESGLFIEPSGRDSLFAHPPMVLTPSVTQSLGD
Bibliography
No article yet recorded