Gene Rv0805
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Hydrolyzes cyclic nucleotide monophosphate to nucleotide monophosphate. Shown to hydrolyze 2',3'-cNMP and 3',5'-cNMP. |
| Product | Class III cyclic nucleotide phosphodiesterase (cNMP PDE) |
| Comments | Rv0805, (MTCY07H7A.04c), len: 318 aa. Cyclic nucleotide phosphodiesterase (cNMP PDE) (See Shenoy et al., 2005), member of binuclear metallophosphoesterase superfamily, equivalent to Q50024 from Mycobacterium leprae (317 aa), FASTA scores: opt: 1713, E(): 0, (82.5% identity in 315 aa overlap). Also shows similarity with hypothetical proteins and icc proteins e.g. SC9B1.22c|T35867 hypothetical protein from Streptomyces coelicolor (305 aa); P36650|ICC_ECOLI icc protein from Escherichia coli (275 aa), FASTA scores: opt: 310, E(): 8.9e-14, (31.3% identity in 214 aa overlap); etc. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, but essential for in vitro growth on cholesterol; by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). M. tuberculosis CDC1551 transposon mutant is attenuated in the central nervous system of BALB/c mice (See Be et al., 2008). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 898831 | 899787 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0805|Rv0805
VHRLRAAEHPRPDYVLLHISDTHLIGGDRRLYGAVDADDRLGELLEQLNQSGLRPDAIVFTGDLADKGEPAAYRKLRGLVEPFAAQLGAELVWVMGNHDDRAELRKFLLDEAPSMAPLDRVCMIDGLRIIVLDTSVPGHHHGEIRASQLGWLAEELATPAPDGTILALHHPPIPSVLDMAVTVELRDQAALGRVLRGTDVRAILAGHLHYSTNATFVGIPVSVASATCYTQDLTVAAGGTRGRDGAQGCNLVHVYPDTVVHSVIPLGGGETVGTFVSPGQARRKIAESGIFIEPSRRDSLFKHPPMVLTSSAPRSPVD
Bibliography
- Shenoy AR, Sreenath N, Podobnik M, Kovacevic M and Visweswariah SS [2005]. The Rv0805 gene from Mycobacterium tuberculosis encodes a 3',5'-cyclic nucleotide phosphodiesterase: biochemical and mutational analysis. Function Product
- Shenoy AR et al. [2007]. Structural and biochemical analysis of the Rv0805 cyclic nucleotide phosphodiesterase from Mycobacterium tuberculosis. Structure
- Keppetipola N and Shuman S [2008]. A phosphate-binding histidine of binuclear metallophosphodiesterase enzymes is a determinant of 2',3'-cyclic nucleotide phosphodiesterase activity. Biochemistry
- Be NA et al. [2008]. Murine model to study the invasion and survival of Mycobacterium tuberculosis in the central nervous system. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
