Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionHydrolyzes cyclic nucleotide monophosphate to nucleotide monophosphate. Shown to hydrolyze 2',3'-cNMP and 3',5'-cNMP.
ProductClass III cyclic nucleotide phosphodiesterase (cNMP PDE)
CommentsRv0805, (MTCY07H7A.04c), len: 318 aa. Cyclic nucleotide phosphodiesterase (cNMP PDE) (See Shenoy et al., 2005), member of binuclear metallophosphoesterase superfamily, equivalent to Q50024 from Mycobacterium leprae (317 aa), FASTA scores: opt: 1713, E(): 0, (82.5% identity in 315 aa overlap). Also shows similarity with hypothetical proteins and icc proteins e.g. SC9B1.22c|T35867 hypothetical protein from Streptomyces coelicolor (305 aa); P36650|ICC_ECOLI icc protein from Escherichia coli (275 aa), FASTA scores: opt: 310, E(): 8.9e-14, (31.3% identity in 214 aa overlap); etc.
Functional categoryIntermediary metabolism and respiration
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, but essential for in vitro growth on cholesterol; by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). M. tuberculosis CDC1551 transposon mutant is attenuated in the central nervous system of BALB/c mice (See Be et al., 2008).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS898831899787+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0805|Rv0805
VHRLRAAEHPRPDYVLLHISDTHLIGGDRRLYGAVDADDRLGELLEQLNQSGLRPDAIVFTGDLADKGEPAAYRKLRGLVEPFAAQLGAELVWVMGNHDDRAELRKFLLDEAPSMAPLDRVCMIDGLRIIVLDTSVPGHHHGEIRASQLGWLAEELATPAPDGTILALHHPPIPSVLDMAVTVELRDQAALGRVLRGTDVRAILAGHLHYSTNATFVGIPVSVASATCYTQDLTVAAGGTRGRDGAQGCNLVHVYPDTVVHSVIPLGGGETVGTFVSPGQARRKIAESGIFIEPSRRDSLFKHPPMVLTSSAPRSPVD