Gene ML2219A
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML2219A, len: 79 aa. Conserved hypothetical protein. Similar to M. tuberculosis Rv0787A Conserved hypothetical protein (79 aa) fasta scores: E(): 4.7e-27, (84.810% identity in 79 aa overlap). Similar to various hypothetical proteins e.g. Streptomyces coelicolor hypothetical protein Q9RKK7 Hypothetical protein SCO4077 (90 aa), fasta scores: E(): 3.6e-18, (68.293% identity in 82 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2636683 | 2636922 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML2219A|ML2219A
VARAVVHVMLRAEILDPQGQAIAGALGRLGHTGISDVRQGKRFELEIDDTVDDSELAMIAESLLANTVIEDWTITRESQ
Bibliography
No article yet recorded