Gene Rv0787A
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved protein |
| Comments | Rv0787A, len: 79 aa. Conserved protein, equivalent to MLCB5.24 hypothetical protein from Mycobacterium leprae (79 aa), FASTA scores: opt: 434, (84.8% identity in 79 aa overlap). Also similar to P12049|YEXA_BACSU hypothetical 9.7 kDa protein from Bacillus subtilis (84 aa), FASTA scores: opt: 172, E(): 4e-06, (44.4% identity in 72 aa overlap). Belongs to the UPF0062 family. |
| Functional category | Conserved hypotheticals |
| Proteomics | Corresponds to protein 5_37 identified by proteomics at the Max Planck Institute for Infecktionsbiologie, Germany (See Jungblut et al., 2001). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 882524 | 882763 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0787A|Rv0787A
VARVVVHVMPKAEILDPQGQAIVGALGRLGHLGISDVRQGKRFELEVDDTVDDTTLAEIAESLLANTVIEDWTISRDPQ
Bibliography
- Jungblut PR, Muller EC, Mattow J and Kaufmann SH [2001]. Proteomics reveals open reading frames in Mycobacterium tuberculosis H37Rv not predicted by genomics. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
