Gene ML2237
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | conserved hypothetical protein (HIT family) |
Comments | ML2237, len: 134 aa. Conserved hypothetical protein. Similar to Mycobacterium leprae hypothetical 14.7 kda protein MLCB5.04C TR:Q9R734 (EMBL:Z95151) fasta scores: E(): 0, 100.0% identity in 134 aa, and P71816|YHI1_MYCTU|Rv0759c Conserved hypothetical protein (133 aa), fasta scores: E(): 7.4e-49, (84.848% identity in 132 aa overlap); and to Borrelia burgdorferi hypothetical 15.9 kda hit-like protein PKCI OR BB0379 SW:YHIT_BORBU (P94252) fasta scores: E(): 5.2e-11, 42.3% identity in 111 aa. Contains Pfam match to entry PF01230 HIT, HIT family. Contains PS00892 HIT family signature. |
Functional category | Conserved hypotheticals |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 2656453 | 2656857 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML2237|ML2237 MATIFTKIINRELPGRFVYEDDDVVAFLTIEPMTQGHTLVVPCAEIDQWQNVDPAIFGRVIAVSQLIGKGVCRAFNAERAGVIIAGFEVPHLHIHVFPTHSLSNFSFANVDRNPSPESLDAAQDKIKAALTQLA
Bibliography
No article yet recorded