Gene Rv0759c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv0759c, (MTCY369.04c), len: 110 aa. Conserved hypothetical protein, highly similar (but shorter 45 aa in N-terminus) to P49774|YHIT_MYCLE|ML2237|MLCB5.04c|U296A hypothetical hit-like protein from Mycobacterium leprae (155 aa), FASTA scores: opt: 766, E(): 0, (78.7% identity in 150 aa overlap). Also highly similar (but N-terminus always shorter) to hit-like proteins and protein kinase inhibitors e.g. AAF72728.1|AF265258_1|AF265258 hit-like protein from Rhodococcus sp. (141 aa); NP_212513.1|NC_001318 protein kinase C1 inhibitor (pkcI) from Borrelia burgdorferi (149 aa) ; P94252|YHIT_BORBU|BB0379 hypothetical hit-like protein from Borrelia burgdorferi (139 aa); NP_110768.1|NC_002689 hit (histidine triad) family protein from Thermoplasma volcanium (158 aa); P16436|IPK1_BOVIN protein kinase C inhibitor 1 (pkci-1) from Bos taurus (Bovine) (125 aa), FASTA scores: opt: 195, E(): 5.2e-08, (33.3% identity in 111 aa overlap); etc. Also shows similarity with Rv2613c|MTCY01A10.20A conserved hypothetical protein from Mycobacterium tuberculosis (195 aa) and Rv1262c|MTCY50.20 hypothetical hit-like protein (144 aa). |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 853825 | 854157 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0759c|Rv0759c
VAFLTIEPMTQGHTLVVPRAEIDHWQNVDPALFGRVMSVSQLIGKAVCRAFSTQRAGMIIAGLEVPHLHIHVFPTRSLSDFGFANVDRNPSPGSLDEAQAKIRAALAQLA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Rodrigue S et al. [2007]. Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. Regulon
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
