Gene ML2330c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML2330c, len: 116 aa. Conserved hypothetical protein. Highly similar to several proteins of undefined function including: Mycobacterium tuberculosis hypothetical protein Rv3716c TR:O69683 (EMBL:AL022121) (133 aa) fasta scores: E(): 4e-27, 83.7% identity in 104 aa, and Escherichia coli hypothetical 12.0 kDa protein SW:YBAB_ECOLI (P17577; P09994) (109 aa) fasta scores: E(): 9.7e-08, 35.0% identity in 100 aa. Note the N-terminus is rich in the amino acid Gln. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2761260 | 2761610 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML2330c|ML2330c
MQPGGDMSALLAQAQQMQQKLLETQQQLANAQVHGQGGGGLVEVVVKGSGEVVSVAIDPKVVDPGDIETLQDLIVGAMADASKQVTKLAQERLGALTSAMRPTAPPPTPPTYMAGT
Bibliography
No article yet recorded