Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved protein
CommentsRv3716c, (MTV025.064c), len: 133 aa. Conserved protein, equivalent to O69519|Y1B6_MYCLE|ML2330|MLCB2407.20 hypothetical 11.9 KDA protein from Mycobacterium leprae (116 aa), FASTA scores: opt: 616, E(): 2.6e-21, (84.55% identity in 110 aa overlap). Also highly similar to hypothetical ~12 kDa proteins in the vicinity of recR from other bacteria e.g. Q9XAI3|YT3D_STRCO|SC66T3.30c hypothetical 11.7 KDA protein from Streptomyces coelicolor (115 aa), FASTA scores: opt: 379, E(): 9.5e-11, (50.8% identity in 122 aa overlap); BAB56641|SAV0479 conserved hypothetical protein from Staphylococcus aureus subsp. aureus Mu50 (105 aa) FASTA scores: opt: 295, E(): 4.9e-07, (41.75% identity in 103 aa overlap); Q99WC4P24281|YAAK_BACSU hypothetical 11.8 KDA protein in DNAZ-RECR intergenic region from Bacillus subtilis (107 aa), FASTA scores: opt: 272, E(): 5.3e-06, (39.4% identity in 104 aa overlap); P17577|YBAB_ECOLI|B0471|Z0588|ECS0524 from Escherichia coli strain K and O157:H7 (109 aa), FASTA scores: opt: 256, E(): 2.8e-05, (38.0% identity in 100 aa overlap); etc. Contains probable coiled-coil domain from aa 1-40. Seems to belong to the UPF0133 family.
Functional categoryConserved hypotheticals
ProteomicsThe product of this CDS corresponds to spot 5_28 identified in culture supernatant by proteomics at the Max Planck Institute for Infection Biology, Berlin, Germany (see citations below). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS41605124160913-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3716c|Rv3716c
MQPGGDMSALLAQAQQMQQKLLEAQQQLANSEVHGQAGGGLVKVVVKGSGEVIGVTIDPKVVDPDDIETLQDLIVGAMRDASQQVTKMAQERLGALAGAMRPPAPPAAPPGAPGMPGMPGMPGAPGAPPVPGI
      
Bibliography