Gene Rv3716c
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Function unknown |
Product | Conserved protein |
Comments | Rv3716c, (MTV025.064c), len: 133 aa. Conserved protein, equivalent to O69519|Y1B6_MYCLE|ML2330|MLCB2407.20 hypothetical 11.9 KDA protein from Mycobacterium leprae (116 aa), FASTA scores: opt: 616, E(): 2.6e-21, (84.55% identity in 110 aa overlap). Also highly similar to hypothetical ~12 kDa proteins in the vicinity of recR from other bacteria e.g. Q9XAI3|YT3D_STRCO|SC66T3.30c hypothetical 11.7 KDA protein from Streptomyces coelicolor (115 aa), FASTA scores: opt: 379, E(): 9.5e-11, (50.8% identity in 122 aa overlap); BAB56641|SAV0479 conserved hypothetical protein from Staphylococcus aureus subsp. aureus Mu50 (105 aa) FASTA scores: opt: 295, E(): 4.9e-07, (41.75% identity in 103 aa overlap); Q99WC4P24281|YAAK_BACSU hypothetical 11.8 KDA protein in DNAZ-RECR intergenic region from Bacillus subtilis (107 aa), FASTA scores: opt: 272, E(): 5.3e-06, (39.4% identity in 104 aa overlap); P17577|YBAB_ECOLI|B0471|Z0588|ECS0524 from Escherichia coli strain K and O157:H7 (109 aa), FASTA scores: opt: 256, E(): 2.8e-05, (38.0% identity in 100 aa overlap); etc. Contains probable coiled-coil domain from aa 1-40. Seems to belong to the UPF0133 family. |
Functional category | Conserved hypotheticals |
Proteomics | The product of this CDS corresponds to spot 5_28 identified in culture supernatant by proteomics at the Max Planck Institute for Infection Biology, Berlin, Germany (see citations below). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 4160512 | 4160913 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3716c|Rv3716c MQPGGDMSALLAQAQQMQQKLLEAQQQLANSEVHGQAGGGLVKVVVKGSGEVIGVTIDPKVVDPDDIETLQDLIVGAMRDASQQVTKMAQERLGALAGAMRPPAPPAAPPGAPGMPGMPGMPGAPGAPPVPGI
Bibliography
- Mollenkopf HJ et al. [1999]. A dynamic two-dimensional polyacrylamide gel electrophoresis database: the mycobacterial proteome via Internet. Proteomics
- Jungblut PR, Schaible UE, Mollenkopf HJ, Zimny-Arndt U, Raupach B, Mattow J, Halada P, Lamer S, Hagens K and Kaufmann SH [1999]. Comparative proteome analysis of Mycobacterium tuberculosis and Mycobacterium bovis BCG strains: towards functional genomics of microbial pathogens. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Mattow J, Schaible UE, Schmidt F, Hagens K, Siejak F, Brestrich G, Haeselbarth G, Muller EC, Jungblut PR and Kaufmann SH [2003]. Comparative proteome analysis of culture supernatant proteins from virulent Mycobacterium tuberculosis H37Rv and attenuated M. bovis BCG Copenhagen. Proteomics
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant