Gene ML2435
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML2435, len: 277 aa. Conserved hypothetical protein. Similar to Mycobacterium tuberculosis hypothetical protein Rv0495c SW:Y495_MYCTU (Q11160) (296 aa) fasta scores: E(): 0, 82.7% identity in 271 aa, and to Streptomyces coelicolor hypothetical protein TR:Q9X8H2 (EMBL:AL049819) (271 aa) fasta scores: E(): 0, 48.4% identity in 250 aa. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 2910203 | 2911036 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML2435|ML2435
VSSCPESGSTFEYVANSHLEPVHPGEEVDLDFTREWVEFYDPDNSEQLIAADLTWLLSRWTCVFGTPACRGTVAGRPDDGCCSHGAFLSDDADRTRLDDAVKKLSHDDWQFREKGLGRKGYLELDEHDGQSQFRTRKHKNACIFLNRPGFPIGAGCALHSKALKLGVPPRTMKPDICWQLPIRHSQEWVTRPDGTEILKTTVTEYDRRSWGSGGADLHWYCTGDPASHVDSKQLWESLADELTELLGAKAYAKLAAICKRRNRLGIIAVHPATQEAK
Bibliography
No article yet recorded