Gene Rv0495c
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Function unknown |
Product | Conserved hypothetical protein |
Comments | Rv0495c, (MTCY20G9.21c), len: 296 aa. Conserved hypothetical protein, highly similar to S72915|B2168_F1_37 hypothetical protein from Mycobacterium leprae (323 aa), FASTA scores: opt: 1615, E(): 0, (82.7% identity in 271 aa overlap); and P54579|Y495_MYCLE|ML243|13094009|CAC31952.1|AL583925 conserved hypothetical protein from Mycobacterium leprae (277 aa). Also highly similar to Q9X8H2|Y716_STRCO|SCE7.16 hypothetical protein from Streptomyces coelicolor (271 aa). |
Functional category | Conserved hypotheticals |
Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, but essential for in vitro growth on cholesterol; by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 585424 | 586314 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0495c|Rv0495c VWRPAQGARWHVPAVLGYGGIPRRASWSNVESVANSRRRPVHPGQEVELDFAREWVEFYDPDNPEHLIAADLTWLLSRWACVFGTPACQGTVAGRPNDGCCSHGAFLSDDDDRTRLADAVHKLTDDDWQFRAKGLRRKGYLELDEHDGQPQHRTRKHKGACIFLNRPGFAGGAGCALHSKALKLGVPPLTMKPDVCWQLPIRRSQEWVTRPDGTEILKTTLTEYDRRGWGSGGADLHWYCTGDPAAHVGTKQVWQSLADELTELLGEKAYGELAAMCKRRSQLGLIAVHPATRAAQ
Bibliography
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant