Gene ML2705c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | ML2705c, len: 259 aa. Conserved hypothetical protein. Similar to Mycobacterium tuberculosis hypothetical 26.6 kda protein Rv3916c TR:O53594 (EMBL:AL021426) fasta scores: E(): 0, 76.4% in 250 aa, and to Streptomyces coelicolor hypothetical 22.6 kda protein TR:Q9R3S2 (EMBL:AF187159) fasta scores: E(): 1e-08, 39.7% in 237 aa. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3260985 | 3261764 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML2705c|ML2705c
VSAQITPLRLEAFEQLPKHARRCVFWEVDPATLGNQDHLVDLEFEKEAWLSMVMLEWGSCGQVATAIMDECRQSDAFKHLEPPCLGYMLYAPPRVVPRAYRFPTAPVSADAVLLTSMGVEPGQVAAGLPQSLISQVIDELVRRGVRALEAFGRTEVATELQDPRTVAPDVRPVLEALGDCSVDHCIIAADFLKAVGFVVVAPHQYFPRLRLELDKGFGWKAEVEAALERLLADAQLQQPVGAGAVVKQHSESRNIWLIR
Bibliography
No article yet recorded