Gene MLPM_0776
in Mycobacterium lepromatosis Mx1-22A
General annotation
Type | CDS |
Function | Unknown |
Product | hypothetical protein |
Comments | - |
Functional category | Conserved hypotheticals |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 107521 | 107625 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium lepromatosis Mx1-22A|MLPM_0776|MLPM_0776 MRSAVVRPPRDGAMPWPQSCQWLLANRVVVNLLC
Bibliography
- Singh P et al. [2015]. Insight into the evolution and origin of leprosy bacilli from the genome sequence of Mycobacterium lepromatosis. Sequence